Serpula lacrymans: SERLADRAFT_460779 Help Entry SERLADRAFT_460779 CDS       T03135                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism sla  Serpula lacrymans Pathway sla03020   RNA polymerase sla03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sla00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SERLADRAFT_460779   09124 Replication and repair    03420 Nucleotide excision repair     SERLADRAFT_460779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sla03021]     SERLADRAFT_460779    03400 DNA repair and recombination proteins [BR:sla03400]     SERLADRAFT_460779 Transcription machinery [BR:sla03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SERLADRAFT_460779   RNA polymerase III system    RNA polymerase III      SERLADRAFT_460779   RNA polymerase I system    RNA polymerase I      SERLADRAFT_460779 DNA repair and recombination proteins [BR:sla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SERLADRAFT_460779 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD MCM_OB zf-C3HC zinc_ribbon_10 HypA TF_Zn_Ribbon zinc-ribbon_6 DZR_2 DUF5816 OrfB_Zn_ribbon Zn-ribbon_8 LysW-like_globular zf-trcl DZR zf-ribbon_3 DUF6083 Motif Other DBs NCBI-GeneID:  18818124 NCBI-ProteinID:  XP_007315501 JGI:  460779 UniProt:  F8NML3 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MNQQGPNSNLGGGGGSYIPPPRQDMEYICADCGAKNEIKSREPIRCRECGHRIMYKKRTK RMVQFEAR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaccagcagggccccaacagcaatctgggaggagggggaggaagctatattcctcct ccacgacaggacatggaatacatttgtgcagattgcggtgccaaaaatgagatcaagtcg agggagcccatacggtgtcgagagtgcggtcaccgtatcatgtataaaaagaggactaag cgcatggtccaattcgaagcgcgttga

DBGET integrated database retrieval system