Streptomyces laurentii: SLA_5782 Help Entry SLA_5782          CDS       T05205                                  Name (GenBank) mbtH protein   KO K05375   MbtH protein Organism slau  Streptomyces laurentii Pathway slau00261   Monobactam biosynthesis slau01100   Metabolic pathways slau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLA_5782  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slau01008]     SLA_5782 Polyketide biosynthesis proteins [BR:slau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLA_5782 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAU86651 UniProt:  A0A160P6N5 LinkDB All DBs Position 6073909..6074124 Genome browser AA seq 71 aa AA seqDB search MANPFDHEEGTFMVLVNDEGQHSLWPSFAEVPAGWTTALGDSDRASALAYIEANWTDMRP KSLVAASEGSA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcgaatccgttcgaccacgaggaggggaccttcatggtccttgtcaacgacgagggg cagcactcgctgtggccgtccttcgccgaggtcccggccggctggacgaccgcgctgggc gactccgaccgggcttccgcgctcgcgtacatcgaggccaactggaccgacatgcgcccc aagagcctggtcgccgcctccgaggggagcgcctga

DBGET integrated database retrieval system