Streptomyces laurentii: SLA_6894 Help Entry SLA_6894          CDS       T05205                                  Name (GenBank) mbtH domain-containing protein   KO K05375   MbtH protein Organism slau  Streptomyces laurentii Pathway slau00261   Monobactam biosynthesis slau01100   Metabolic pathways slau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLA_6894  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slau01008]     SLA_6894 Polyketide biosynthesis proteins [BR:slau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLA_6894 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAU87760 UniProt:  A0A160P9M3 LinkDB All DBs Position 7284248..7284463 Genome browser AA seq 71 aa AA seqDB search MSNPFEDDNASYRVLVNAEEQYSLWPDFAEVPAGWTVALPSTTRQECLDYVNEHWVDMRP KSLVDAMRQDG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccattcgaggacgacaatgcctcctaccgtgttctcgtcaacgcggaggag cagtattcgctgtggccggatttcgcggaggtcccggccggctggaccgtcgccctgccg agcacgacccggcaggagtgcctggactacgtgaacgaacactgggtcgacatgcgcccc aagagcctggtcgacgcgatgcgtcaggacggctga

DBGET integrated database retrieval system