Streptomyces laurentii: SLA_7259 Help Entry SLA_7259          CDS       T05205                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism slau  Streptomyces laurentii Pathway slau00261   Monobactam biosynthesis slau01100   Metabolic pathways slau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLA_7259  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slau01008]     SLA_7259 Polyketide biosynthesis proteins [BR:slau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLA_7259 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAU88125 UniProt:  A0A169PKC9 LinkDB All DBs Position 7693298..7693498 Genome browser AA seq 66 aa AA seqDB search MTHPFDDPSGYRVLINSLEQHSVWPSGIRVPAGWSPVFGPDSRQACHHYVESRWSDMRPA TVRTTR NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgacgcacccgttcgacgaccccagcggctaccgggtcctcatcaacagcctggaacag cacagcgtgtggccgagcggcatccgtgtgcccgccggatggtccccggtgttcggcccg gacagccgacaggcatgccaccactacgtcgaatcccgctggagcgacatgcgccccgcc accgtgcggaccacccggtga

DBGET integrated database retrieval system