Streptomyces laurentii: SLA_7485 Help Entry SLA_7485          CDS       T05205                                  Name (GenBank) mbtH protein   KO K05375   MbtH protein Organism slau  Streptomyces laurentii Pathway slau00261   Monobactam biosynthesis slau01100   Metabolic pathways slau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLA_7485  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slau01008]     SLA_7485 Polyketide biosynthesis proteins [BR:slau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLA_7485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAU88350 UniProt:  A0A160PAW5 LinkDB All DBs Position 7963826..7964035 Genome browser AA seq 69 aa AA seqDB search MTNPFENADGRYLVLVNDEGQHSLWPDFAEVPAGWEVAFGESDRQACLDHIEANWTDMRP KSLVRAMAS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgagaacgccgacggccgctacctcgtcctcgtcaacgacgagggc cagcactccctgtggccggacttcgccgaggtcccggccggctgggaggtcgccttcggg gagagcgaccgccaggcctgcctcgaccacatcgaggccaactggacggacatgcgcccg aagagcctcgtccgcgcgatggcgtcctga

DBGET integrated database retrieval system