KEGG Orthology (KO) [BR:slb00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
AWJ20_1846 (RPO26)
09124 Replication and repair
03420 Nucleotide excision repair
AWJ20_1846 (RPO26)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:slb03021]
AWJ20_1846 (RPO26)
03400 DNA repair and recombination proteins [BR:slb03400]
AWJ20_1846 (RPO26)
Transcription machinery [BR:slb03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
AWJ20_1846 (RPO26)
RNA polymerase III system
RNA polymerase III
AWJ20_1846 (RPO26)
RNA polymerase I system
RNA polymerase I
AWJ20_1846 (RPO26)
DNA repair and recombination proteins [BR:slb03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
AWJ20_1846 (RPO26)
158 aa
MSDDEGAFNDGYENAYDEADFEEHFSDDGDFETNGAVNGNENGTAVAAQEIDADGRTVIV
SNQDQAPRKKTAKELAIPKEKRATTPYMTKYERARVLGTRALQISMNAPVLVDLEGETDP
LQIAMKELAQRKIPLVIRRYLPDGSYEDWGCDELIVDQ
