Streptomyces lydicus 103: SL103_21615 Help Entry SL103_21615       CDS       T04699                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism slc  Streptomyces lydicus 103 Pathway slc00261   Monobactam biosynthesis slc01100   Metabolic pathways slc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SL103_21615  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slc01008]     SL103_21615 Polyketide biosynthesis proteins [BR:slc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SL103_21615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOP48486 UniProt:  A0A1D7VNZ8 LinkDB All DBs Position complement(4961342..4961542) Genome browser AA seq 66 aa AA seqDB search MTNPFEDADGTYLVLTNDDNQHSLWPARLAPPMGWTVAHGAAGYQACLDYVDAHWTDLTP KPALGH NT seq 201 nt NT seq  +upstreamnt  +downstreamnt gtgacgaaccccttcgaagacgccgacgggacctacctggtcctgaccaatgacgacaac cagcactccctgtggccggcgcgactggcaccccccatgggctggaccgtggcgcacggt gcggccggctaccaggcgtgcctcgactacgtcgacgcgcactggaccgacctgacaccg aagccggccctcggccactga

DBGET integrated database retrieval system