Streptomyces lydicus 103: SL103_26550 Help Entry SL103_26550       CDS       T04699                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism slc  Streptomyces lydicus 103 Pathway slc00261   Monobactam biosynthesis slc01100   Metabolic pathways slc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SL103_26550  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slc01008]     SL103_26550 Polyketide biosynthesis proteins [BR:slc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SL103_26550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOP49335 UniProt:  A0A1D7VRF4 LinkDB All DBs Position 6118606..6118827 Genome browser AA seq 73 aa AA seqDB search MNPFDDENGTFKVLVNPEGQYSLWPAFAPVPPGWEVRLDDRPRAECTGYVEEHWTDLRPA SLVAATAAPDSRS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgacgagaacggcaccttcaaggtcctggtgaaccccgagggccag tactcgctgtggcccgccttcgcaccggtcccgccgggctgggaggtacggctggacgac cgcccccgtgcggagtgcaccgggtacgtcgaggagcactggaccgatctgcggccggcc tccctcgtcgcagcgacggccgcgccggactcccggagctga

DBGET integrated database retrieval system