Streptomyces lydicus 103: SL103_33965 Help Entry SL103_33965       CDS       T04699                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism slc  Streptomyces lydicus 103 Pathway slc00261   Monobactam biosynthesis slc01100   Metabolic pathways slc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SL103_33965  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slc01008]     SL103_33965 Polyketide biosynthesis proteins [BR:slc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SL103_33965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AOP50601 UniProt:  A0A1D7VV26 LinkDB All DBs Position 7842068..7842295 Genome browser AA seq 75 aa AA seqDB search MGVNPFDDPDGRYLVLVNDEDQHSLWPAFAEVPAGWTVALAETDRQAALDFVTGNWTDMR PRSLVKAMETTAESV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgggcgttaaccccttcgacgaccccgacggcaggtatctggtactggtcaacgacgag gaccagcattcgctctggccggccttcgccgaggtgcccgcgggctggacggtggccctc gcggagaccgaccgccaggcggcgctggacttcgtcaccgggaactggaccgacatgcgg ccgcgcagcctggtgaaggcgatggaaacgaccgccgagtcggtctga

DBGET integrated database retrieval system