Streptomyces lydicus A02: T261_7683 Help Entry T261_7683         CDS       T03756                                  Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism sld  Streptomyces lydicus A02 Pathway sld00261   Monobactam biosynthesis sld01100   Metabolic pathways sld01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sld00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     T261_7683  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sld01008]     T261_7683 Polyketide biosynthesis proteins [BR:sld01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     T261_7683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJT69280 LinkDB All DBs Position 8292516..8292734 Genome browser AA seq 72 aa AA seqDB search MTTNPFDDAEGEFSVLANDEEQHSLWPARSEVPAGWRVVFGPGERKAALEYVEANWTDLR PKSLRELMANGS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaaccccttcgacgacgccgaaggcgagttctccgtgctggccaacgacgag gagcagcactccttgtggccggcccgttccgaggtgcccgccggctggcgggtcgtcttc ggccccggtgaacgaaaggccgccctggagtacgtagaggccaactggaccgatctccgg ccgaagagcctccgcgagctcatggccaacggctcatga

DBGET integrated database retrieval system