Streptomyces leeuwenhoekii: sle_06560 Help Entry sle_06560         CDS       T04414                                  Symbol sle_06560 Name (GenBank) Protein mbtH   KO K05375   MbtH protein Organism sle  Streptomyces leeuwenhoekii Pathway sle00261   Monobactam biosynthesis sle01100   Metabolic pathways sle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sle00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     sle_06560 (sle_06560)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sle01008]     sle_06560 (sle_06560) Polyketide biosynthesis proteins [BR:sle01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     sle_06560 (sle_06560) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Lpp-LpqN Motif Other DBs NCBI-ProteinID:  CQR60119 UniProt:  A0A0F7VL66 LinkDB All DBs Position chromosome:complement(735546..735749) Genome browser AA seq 67 aa AA seqDB search MDENTRYQVLRNDEDQYSLWPVDVDVPAGWQPVGKEGTEAECTAYVDEVWTDMRPRSLRE RMENAGA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggacgagaacacccgctaccaggtgctgcgcaacgacgaggaccagtactccctctgg ccggtcgacgtcgacgtgcccgccggctggcagcccgtcggcaaggagggcaccgaggcc gagtgcacggcctacgtcgacgaggtgtggaccgacatgcgcccgcgcagcctgcgggag cggatggagaacgccggggcctga

DBGET integrated database retrieval system