Streptomyces leeuwenhoekii: sle_62440 Help Entry sle_62440         CDS       T04414                                  Symbol sle_62440 Name (GenBank) MbtH Domain-Containing Protein   KO K05375   MbtH protein Organism sle  Streptomyces leeuwenhoekii Pathway sle00261   Monobactam biosynthesis sle01100   Metabolic pathways sle01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sle00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     sle_62440 (sle_62440)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sle01008]     sle_62440 (sle_62440) Polyketide biosynthesis proteins [BR:sle01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     sle_62440 (sle_62440) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CQR65699 UniProt:  A0A0F7VYX2 LinkDB All DBs Position chromosome:7335450..7335704 Genome browser AA seq 84 aa AA seqDB search MTPKPGDDDRLYEVVVNHEEQYSLWPADRDDPAGWSDAGRTGPRSDCLAPIKEVWTAMRP PRPRHRPEACGQPGPAAPDTGGAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgccgaagcccggcgatgacgaccggctgtacgaggtcgtggtcaaccacgaggag cagtactccctctggcccgccgaccgggacgacccggccggctggtcggacgcgggcagg accggccccaggagcgactgcctcgcccccatcaaggaggtgtggaccgccatgcgcccg ccgcgtccgcgccaccgcccggaagcctgcgggcagcccgggccggccgcaccggacacc ggcggcgcgggctga

DBGET integrated database retrieval system