Streptomyces liliifuscus: JEQ17_08235 Help Entry JEQ17_08235       CDS       T08169                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism slf  Streptomyces liliifuscus Pathway slf00261   Monobactam biosynthesis slf01100   Metabolic pathways slf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JEQ17_08235  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slf01008]     JEQ17_08235 Polyketide biosynthesis proteins [BR:slf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JEQ17_08235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QQM39453 UniProt:  A0A7T7KUX3 LinkDB All DBs Position complement(1908540..1908752) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDTEGRFLVLVNDEGQHSLWPSFATVPGGWTVAFDENTREACLDFIEANWTDLR PRSLAASMDV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccctttcgacgacaccgaaggccgcttcctggttctggtgaacgacgag ggccagcactcgctctggccgtccttcgccaccgtgcccggggggtggacggtcgccttc gacgagaacacccgagaggcgtgcctggacttcatcgaggccaactggaccgatctgcgc ccccggtccctcgcggcttccatggacgtgtga

DBGET integrated database retrieval system