Streptomyces liangshanensis: HA039_08020 Help Entry HA039_08020       CDS       T07519                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism slia  Streptomyces liangshanensis Pathway slia00261   Monobactam biosynthesis slia01100   Metabolic pathways slia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HA039_08020  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slia01008]     HA039_08020 Polyketide biosynthesis proteins [BR:slia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HA039_08020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIQ02255 UniProt:  A0A6G9GVK6 LinkDB All DBs Position complement(1889526..1889693) Genome browser AA seq 55 aa AA seqDB search MFAVVVNHEEQYSVWPTDQEIPAGWRAEGTRGTRDECLARIGEVWTDLRPLSARP NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgtttgcggtggtcgtcaatcacgaggagcagtactcggtctggccgacggaccaggag atcccggcggggtggcgcgccgaggggacgcgcgggacgcgggacgagtgcctggcgagg atcggcgaggtctggacagacctccgccccttgagcgcccgcccctga

DBGET integrated database retrieval system