Streptomyces liangshanensis: HA039_30190 Help Entry HA039_30190       CDS       T07519                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism slia  Streptomyces liangshanensis Pathway slia00261   Monobactam biosynthesis slia01100   Metabolic pathways slia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HA039_30190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slia01008]     HA039_30190 Polyketide biosynthesis proteins [BR:slia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HA039_30190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIQ06011 UniProt:  A0A6G9H721 LinkDB All DBs Position 6956935..6957138 Genome browser AA seq 67 aa AA seqDB search MSSSNPFENPEGVYSVLVNDEGQHSLWPDFAEIPAGWTRTHGPTTRESCLTHIEETWTDL RPKSLTL NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcagcagcaacccgttcgagaaccccgagggcgtctactccgtcctggtcaacgac gagggccagcacagcctgtggccggacttcgcggagatccccgcgggctggacgaggacc cacggcccgacgacccgcgagtcctgcctgacccacatagaggaaacctggaccgacctc cgcccgaagagcctgaccctctga

DBGET integrated database retrieval system