Streptomyces lunaelactis: SLUN_13700 Help Entry SLUN_13700        CDS       T06347                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism slk  Streptomyces lunaelactis Pathway slk00261   Monobactam biosynthesis slk01100   Metabolic pathways slk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLUN_13700  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slk01008]     SLUN_13700 Polyketide biosynthesis proteins [BR:slk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLUN_13700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVZ73083 UniProt:  A0A2R4T1S0 LinkDB All DBs Position 3040598..3040813 Genome browser AA seq 71 aa AA seqDB search MSDGSAADGSYLVVVNDEQQYSIWWAERTLPDGWYAEGGRGSREECLARIDEVWTDMRPL SLRRRMESAGV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgacggcagcgctgcggacggctcgtacctggtggtcgtcaacgacgagcagcag tactcgatctggtgggcggaacgtacgcttccggacggctggtacgcagaggggggccgg ggcagccgcgaggagtgcctggcccgtatcgacgaggtgtggaccgacatgcgcccgctc agcctgcgccggcggatggaatccgcgggggtctga

DBGET integrated database retrieval system