Streptomyces lunaelactis: SLUN_22190 Help Entry SLUN_22190        CDS       T06347                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism slk  Streptomyces lunaelactis Pathway slk00261   Monobactam biosynthesis slk01100   Metabolic pathways slk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLUN_22190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slk01008]     SLUN_22190 Polyketide biosynthesis proteins [BR:slk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLUN_22190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVZ74467 UniProt:  A0A2R4T5U9 LinkDB All DBs Position complement(4833643..4833861) Genome browser AA seq 72 aa AA seqDB search MSNPFEDADGTYLVLVNGENQHSLWPSFVAVPEGWAAAFGEARREECLAYIEENWTDMRP KSLVDEMATSAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcccttcgaggacgcggacggcacctacctcgtgctggtcaacggcgagaac cagcactcgctgtggccctcgttcgtcgcggtgcccgagggctgggcagcggccttcggg gaggcccgccgcgaagagtgcctggcgtacatcgaggagaactggaccgacatgcggccc aagagcctcgtcgacgagatggcgacctccgcgcgatag

DBGET integrated database retrieval system