Streptomyces lunaelactis: SLUN_38420 Help Entry SLUN_38420        CDS       T06347                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism slk  Streptomyces lunaelactis Pathway slk00261   Monobactam biosynthesis slk01100   Metabolic pathways slk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLUN_38420  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:slk01008]     SLUN_38420 Polyketide biosynthesis proteins [BR:slk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLUN_38420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2992 Motif Other DBs NCBI-ProteinID:  AVZ77912 UniProt:  A0A2R4TFK2 LinkDB All DBs Position pSLUN1:20304..20516 Genome browser AA seq 70 aa AA seqDB search MSSNLFDDADGRFYVLVNEEEQHSLWPSFVDVPAGWRVVFGEEGHQQCLDFIEQNWTDLR PKSLREAMAA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaacctgttcgatgacgcggatggccggttctatgtcctggtgaacgaggag gagcagcactccctgtggccgtcgttcgtcgacgttcccgccggctggcgggtggtgttc ggcgaggagggccaccagcagtgcctggactttatcgagcagaactggaccgacctgcga ccgaagagcctgcgtgaggcgatggccgcgtaa

DBGET integrated database retrieval system