Salipaludibacillus sp. LMS25: MM221_09205 Help Entry MM221_09205       CDS       T08296                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism slms  Salipaludibacillus sp. LMS25 Pathway slms00790   Folate biosynthesis slms01100   Metabolic pathways slms01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:slms00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MM221_09205 (folB) Enzymes [BR:slms01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MM221_09205 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MM221_09205 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MM221_09205 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF5101 Motif Other DBs NCBI-ProteinID:  UTR16679 LinkDB All DBs Position 2003662..2004030 Genome browser AA seq 122 aa AA seqDB search MDKILVQGMAFYGYHGVFVEENKLGQRFYADVTLEMDTRPAGKSDDLNQTVNYALVYETA KDILEGKSVQLVETLTERLANALLEKFPIIDACTVKVIKPDPPIPGHYEAVAVEIRRERE GV NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggacaaaatattagtacaaggtatggccttttatggctaccatggcgtatttgtggaa gaaaataagctaggacaacgtttttatgcagatgttacccttgaaatggacacgaggcct gctgggaaaagtgatgacttaaatcaaaccgttaactatgctttagtatatgaaacagca aaagacattttagaaggcaagtctgtccagttagtagaaacgttaactgaacggctggcg aacgccctgttagagaaatttccaattattgatgcctgcacggtaaaagtgataaaacct gatcctcctataccagggcattacgaagcagtggctgttgaaatccgtagagaacgggaa ggtgtctga

DBGET integrated database retrieval system