Syntrophothermus lipocalidus: Slip_2318 Help Entry Slip_2318         CDS       T01253                                  Name (GenBank) conserved hypothetical protein   KO K03048   DNA-directed RNA polymerase subunit delta Organism slp  Syntrophothermus lipocalidus Pathway slp03020   RNA polymerase Brite KEGG Orthology (KO) [BR:slp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Slip_2318  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:slp03021]     Slip_2318    03400 DNA repair and recombination proteins [BR:slp03400]     Slip_2318 Transcription machinery [BR:slp03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      Slip_2318 DNA repair and recombination proteins [BR:slp03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       Slip_2318 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HARE-HTH Motif Other DBs NCBI-ProteinID:  ADI03057 UniProt:  D7CK73 LinkDB All DBs Position complement(2335332..2335544) Genome browser AA seq 70 aa AA seqDB search MTAKKSEADWAYEVLRNREGPVYYRELVETVLQFMNREINPRNMAAVYTQINLDNRFGYM GDGYWALKVR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttgaccgctaagaaaagcgaggcagattgggcttacgaggttttgcgaaaccgggaaggt cctgtgtattaccgagaactggtggaaactgtattacagtttatgaaccgggagatcaac ccgcgcaacatggccgccgtttatacccagattaatctcgataaccggtttggttatatg ggagatggatactgggcattgaaggtcagatag

DBGET integrated database retrieval system