Streptomyces lincolnensis: SLINC_0741 Help Entry SLINC_0741        CDS       T04801                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sls  Streptomyces lincolnensis Pathway sls00261   Monobactam biosynthesis sls01100   Metabolic pathways sls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sls00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLINC_0741  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sls01008]     SLINC_0741 Polyketide biosynthesis proteins [BR:sls01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLINC_0741 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Topo_Zn_Ribbon Motif Other DBs NCBI-ProteinID:  ANS62965 UniProt:  A0A1B1M2T8 LinkDB All DBs Position complement(883232..883444) Genome browser AA seq 70 aa AA seqDB search MTTNPFDDDTLEHYVLVNDEGQHSLWPAFSEVPAGWTVVHGRASRQSCVEYVEEHWTDMR PKSLIRAMGE NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaaccccttcgacgacgacacccttgagcactacgtcctcgtcaacgacgag ggccagcactccctgtggccggccttctccgaggtcccggccggctggaccgtcgtccac ggccgcgcgagccgccagtcgtgcgtggagtacgtcgaggagcactggaccgacatgcga ccgaagagcctgatccgggccatgggtgaatga

DBGET integrated database retrieval system