Streptomyces lincolnensis: SLINC_4871 Help Entry SLINC_4871        CDS       T04801                                  Name (GenBank) Dbv15 protein   KO K05375   MbtH protein Organism sls  Streptomyces lincolnensis Pathway sls00261   Monobactam biosynthesis sls01100   Metabolic pathways sls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sls00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SLINC_4871  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sls01008]     SLINC_4871 Polyketide biosynthesis proteins [BR:sls01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SLINC_4871 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANS67095 UniProt:  A0A1B1MEP6 LinkDB All DBs Position 5826343..5826555 Genome browser AA seq 70 aa AA seqDB search MTTADAEAAERFVVVVNDEGHHSLWWYGRPVPPGWRATSEPATREECLARIERDWTGLRP RRRLAAVDPR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgacgacagcagacgctgaggcggccgagcggttcgtcgtggtcgtgaacgacgagggc caccactccctgtggtggtacggccggcccgtgcccccgggctggcgggccacctcggag cccgccacccgcgaggagtgcctcgcccggatcgagcgggactggacgggcctgcgcccg aggcggcggctcgcggcggtggaccctcgatga

DBGET integrated database retrieval system