Sulfurovum mangrovi: LN246_13540 Help Entry LN246_13540       CDS       T09512                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism smab  Sulfurovum mangrovi Pathway smab00020   Citrate cycle (TCA cycle) smab01100   Metabolic pathways smab01110   Biosynthesis of secondary metabolites smab01120   Microbial metabolism in diverse environments smab01200   Carbon metabolism smab01210   2-Oxocarboxylic acid metabolism Module smab_M00009   Citrate cycle (TCA cycle, Krebs cycle) smab_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate smab_M00173   Reductive citrate cycle (Arnon-Buchanan cycle) Brite KEGG Orthology (KO) [BR:smab00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LN246_13540 Enzymes [BR:smab01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LN246_13540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_6 Fer4_21 Fer4_16 Fer4_2 Fer4_9 Fer4_4 Fer4_8 Fer4_17 Fer4_13 Fer4_22 Fer4_3 ETF_QO Motif Other DBs NCBI-ProteinID:  UFH60598 LinkDB All DBs Position unnamed:103837..104169 Genome browser AA seq 110 aa AA seqDB search MAVMTAPENTPVWVNTARCKACDICVDACPAGVLSMKAEPSSTLGAMISVIAPDSCIGCN ECELSCPDFAIYVAEKSEFKFAKLSDAAKARQEAITNNGYRLPADYKEAN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcagtaatgacagcaccagagaatactccggtatgggtaaatacagctagatgtaaa gcttgcgatatctgtgtggatgcatgtccggcaggtgtactttctatgaaggcagagcca agttcaacactcggtgcaatgatttcagtaattgcacctgattcatgtattggatgtaac gagtgtgaactttcatgtccagactttgcaatatatgttgctgagaagagcgaatttaaa tttgctaaactttctgacgcggcaaaagcaagacaagaagcaattacaaataatgggtat agactacctgcggactataaggaggctaactaa

DBGET integrated database retrieval system