Serratia sp. FGI94: D781_2011 Help Entry D781_2011         CDS       T02433                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism smaf  Serratia sp. FGI94 Pathway smaf00261   Monobactam biosynthesis smaf01100   Metabolic pathways smaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smaf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D781_2011  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smaf01008]     D781_2011 Polyketide biosynthesis proteins [BR:smaf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D781_2011 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGB82292 UniProt:  L0MG66 LinkDB All DBs Position 2116590..2116817 Genome browser AA seq 75 aa AA seqDB search MTQEQQNPFDDESLPFLVLINQQQQYSLWPQFAAVPAGWHEVMGPATRAECIAFIEAHWQ DMRPAALKNSVTPAQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgactcaggaacaacaaaacccttttgatgatgaaagcctgccgtttttggtgctgatc aatcagcaacagcagtattcgctgtggccgcagtttgccgccgtgccggcaggctggcac gaggtgatggggccggcgacgcgcgccgagtgcatcgcgtttatcgaagcgcattggcag gacatgcgccccgcggcgctgaaaaacagcgtgacgccggcgcagtaa

DBGET integrated database retrieval system