Serratia sp. FGI94: D781_3214 Help Entry D781_3214         CDS       T02433                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism smaf  Serratia sp. FGI94 Pathway smaf00261   Monobactam biosynthesis smaf01100   Metabolic pathways smaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smaf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D781_3214  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smaf01008]     D781_3214 Polyketide biosynthesis proteins [BR:smaf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D781_3214 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGB83438 UniProt:  L0MHT9 LinkDB All DBs Position complement(3383890..3384099) Genome browser AA seq 69 aa AA seqDB search MDMQNPFDDPQQRCLILCNAQQQYSLWPDFSPAPAGWRTVFGPAERTECVGWLETHPQDM RPAAQREQQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacatgcagaacccgtttgacgacccgcagcagcgttgcctgattctgtgcaatgcg cagcagcagtacagcctgtggcccgacttcagcccggccccggccggctggcgtacggtg ttcggcccggcggagcgcaccgagtgcgtcggctggctggaaacgcacccgcaggacatg cggcccgccgcgcagcgtgagcaacaataa

DBGET integrated database retrieval system