Streptomyces malaysiensis: SMALA_0084 Help Entry SMALA_0084        CDS       T05189                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_0084  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_0084 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_0084 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL80330 UniProt:  A0A291SHJ1 LinkDB All DBs Position 100102..100323 Genome browser AA seq 73 aa AA seqDB search MHDEQRDERSYRVVVNDEEQYSIWPGDRELPGGWREEGTRGDRETCLAHIDRVWTDMRPR SLREELARPRQGG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcacgacgagcagcgtgatgagcggtcgtaccgcgtcgtggtgaacgacgaggagcag tactccatctggcccggcgaccgtgaactgcccgggggctggcgcgaggaggggacgcgc ggggaccgcgagacctgcctggcccatatcgaccgcgtgtggaccgatatgcggcccagg agtctgcgcgaggaactggcccgcccccggcagggcggctga

DBGET integrated database retrieval system