Streptomyces malaysiensis: SMALA_2691 Help Entry SMALA_2691        CDS       T05189                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_2691  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_2691 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_2691 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL82925 UniProt:  A0A291SPY9 LinkDB All DBs Position complement(3423373..3423591) Genome browser AA seq 72 aa AA seqDB search MSNPFENPDGRYLVLVNEEGQHSLWPAFAEVPAGWTVAHGEDDRQACLDHINEHWTDMRP KSLITTMDGTPA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaaccccgacggccgttatctcgtgctcgtcaacgaggagggg cagcactcgctgtggccggccttcgccgaggtccccgcgggctggacggtcgcccacggg gaggacgaccgccaggcgtgcctggaccacatcaacgagcactggaccgatatgcggccc aagagcctgatcaccacgatggacggcaccccggcctga

DBGET integrated database retrieval system