Streptomyces malaysiensis: SMALA_5821 Help Entry SMALA_5821        CDS       T05189                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_5821  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_5821 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_5821 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL86049 UniProt:  A0A291SYU5 LinkDB All DBs Position 7170413..7170625 Genome browser AA seq 70 aa AA seqDB search MSNPFENAEGRFFVLVNDERQYSLWPAFAEVPAGWTVVHGEDTREACLEHIDQNWTDMRP KSLVDAMNAV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgagaacgccgagggccgcttcttcgtcctggtcaacgacgagcgg cagtactccctctggccggccttcgccgaggtcccggccggctggacggtcgtccacggc gaggacacccgcgaggcgtgcctggagcacatcgaccagaactggaccgacatgcggccc aagagcctggtcgacgcgatgaacgccgtctga

DBGET integrated database retrieval system