Streptomyces malaysiensis: SMALA_7574 Help Entry SMALA_7574        CDS       T05189                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_7574  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_7574 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_7574 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF5076 Motif Other DBs NCBI-ProteinID:  ATL87790 UniProt:  A0A291T3X0 LinkDB All DBs Position 9495772..9495996 Genome browser AA seq 74 aa AA seqDB search MSTNPFEDPEGTYLVLVNDEGQHSLWPAFVEVPQGWRTVLADATRDAALEYVNTNWTDMR PKSLIKAMEGAGAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgaggaccccgagggcacctatctcgtgctcgtcaacgatgag gggcagcactcattgtggccggcgttcgtcgaggttccccagggctggcgcacggttctg gccgacgccacgcgggacgcggcgctcgaatacgtgaacaccaactggaccgatatgcgc cccaagagcctgatcaaggcgatggaaggcgccggcgcggcctga

DBGET integrated database retrieval system