Streptomyces malaysiensis: SMALA_7735 Help Entry SMALA_7735        CDS       T05189                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_7735  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_7735 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_7735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL87951 UniProt:  A0A291T4K7 LinkDB All DBs Position 9690131..9690337 Genome browser AA seq 68 aa AA seqDB search MNPFDDPDAEFLVLVNHEGQYSLWPAFADVPEGWTVDHDKDTREACLAHIEENWTDMRPK SLIEAMGG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgaatcccttcgacgatcccgacgcggaatttctggtgctggtcaaccacgaggggcag tactcgctgtggccggccttcgcggatgtacccgagggatggacggtcgaccatgacaag gacacccgcgaagcgtgcctggcccatatcgaggagaactggacggatatgcggcccaag agcctgatcgaggcgatgggcggctga

DBGET integrated database retrieval system