Streptomyces malaysiensis: SMALA_7827 Help Entry SMALA_7827        CDS       T05189                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_7827  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_7827 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_7827 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH VEFS-Box Motif Other DBs NCBI-ProteinID:  ATL88037 UniProt:  A0A291T4H9 LinkDB All DBs Position 9846431..9846643 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDSEGRFLVLVNDEGQHSLWPSFAEVPGGWTVVFDENTRAACLEFIEAHWTDMR PRSLAASADG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacagcgaaggccgtttcctggtcctggtgaacgacgag ggccagcactccctctggccgtccttcgccgaggtgcccgggggatggacggtcgtcttc gacgagaacacccgagcggcgtgtctggagttcatcgaggcccactggaccgatatgcgc ccccggtccctcgcggcatccgcggacggctga

DBGET integrated database retrieval system