Streptomyces malaysiensis: SMALA_8507 Help Entry SMALA_8507        CDS       T05189                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism smal  Streptomyces malaysiensis Pathway smal00261   Monobactam biosynthesis smal01100   Metabolic pathways smal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMALA_8507  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smal01008]     SMALA_8507 Polyketide biosynthesis proteins [BR:smal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMALA_8507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH PAGK DUF2278 Motif Other DBs NCBI-ProteinID:  ATL88716 UniProt:  A0A291T6E5 LinkDB All DBs Position 10662216..10662431 Genome browser AA seq 71 aa AA seqDB search MNPFDDPDGTFLVVVNDQNQHALWPTFAPVPDGWHEAHPAAPRDVCLDHIERTWTDLAPG GTARHADPATG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgaaccccttcgacgacccggacggcaccttcctcgtcgtggtcaacgaccagaaccag cacgccctgtggcccaccttcgccccggtgcccgacggatggcacgaggcgcacccggcc gcaccccgggacgtgtgcctggaccacatcgagcgcacctggacggacctcgccccgggc ggtacggcccgccacgcggatccggccaccggctga

DBGET integrated database retrieval system