Scophthalmus maximus (turbot): 118315197 Help Entry 118315197         CDS       T09850                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04012   ErbB signaling pathway smau04068   FoxO signaling pathway smau04137   Mitophagy - animal smau04140   Autophagy - animal smau04150   mTOR signaling pathway smau04210   Apoptosis smau04218   Cellular senescence smau04370   VEGF signaling pathway smau04371   Apelin signaling pathway smau04540   Gap junction smau04625   C-type lectin receptor signaling pathway smau04810   Regulation of actin cytoskeleton smau04910   Insulin signaling pathway smau04912   GnRH signaling pathway smau04914   Progesterone-mediated oocyte maturation smau04916   Melanogenesis Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118315197 (kras)    04012 ErbB signaling pathway     118315197 (kras)    04370 VEGF signaling pathway     118315197 (kras)    04371 Apelin signaling pathway     118315197 (kras)    04068 FoxO signaling pathway     118315197 (kras)    04150 mTOR signaling pathway     118315197 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118315197 (kras)    04137 Mitophagy - animal     118315197 (kras)   09143 Cell growth and death    04210 Apoptosis     118315197 (kras)    04218 Cellular senescence     118315197 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     118315197 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118315197 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118315197 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     118315197 (kras)    04912 GnRH signaling pathway     118315197 (kras)    04914 Progesterone-mediated oocyte maturation     118315197 (kras)    04916 Melanogenesis     118315197 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118315197 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:smau04031]     118315197 (kras) Membrane trafficking [BR:smau04131]  Endocytosis   Macropinocytosis    Ras GTPases     118315197 (kras) GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118315197 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  118315197 NCBI-ProteinID:  XP_035498162 EnsemblRapid:  ENSSMAG00025019009 LinkDB All DBs Position 7:17933038..17944964 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPSIETSAKTRQRVEDAFYTLVREIRLYRLNKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagctggtagtagtgggagctggtggcgttggcaagagcgcccttacc attcagcttatccagaatcactttgtggatgaatatgaccccaccattgaggactcctac agaaagcaggtagtgattgacggagagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaataacaccaagtcctttgaggacattcaccactatagagaacagatt aagcgggtgaaagactctgaggacgtccccatggtgctggtggggaacaagtgtgacctc ccgtcccggacagtggacaccaagcaggctcaggacttagcacgcagctacggaattccc tctatcgagacctcagcaaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggctgtaccggctcaataagctcagcaaggaagaaaagacgccgcgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system