Schistosoma mansoni: Smp_132030 Help Entry Smp_132030        CDS       T01095                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism smm  Schistosoma mansoni Pathway smm03020   RNA polymerase smm03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smm00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Smp_132030   09124 Replication and repair    03420 Nucleotide excision repair     Smp_132030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smm03021]     Smp_132030    03400 DNA repair and recombination proteins [BR:smm03400]     Smp_132030 Transcription machinery [BR:smm03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Smp_132030   RNA polymerase III system    RNA polymerase III      Smp_132030   RNA polymerase I system    RNA polymerase I      Smp_132030 DNA repair and recombination proteins [BR:smm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Smp_132030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD DUF5816 Motif Other DBs NCBI-GeneID:  8350903 NCBI-ProteinID:  XP_018654862 LinkDB All DBs Position W:32790976..32798771 Genome browser AA seq 97 aa AA seqDB search MESRSGSGATPAANSATHLSKTVSYICGECRAENEIRPRELVRCLECGHRVLYKKRSKRK MSFCAVIFLFFLKLTDLVYAKGDYVYFYLPVPFLSAA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggagagtaggagtgggagcggtgctacaccagctgcaaattctgcgactcacttgtca aaaactgtttcctatatatgcggagaatgtcgggctgaaaatgaaattcgacccagagag cttgttcgctgtcttgagtgtggacacagagtcctatacaagaaacggtcaaaacgaaag atgtcattttgtgcagtgatctttttattctttctgaagttaactgatcttgtgtatgca aagggtgactatgtttacttctacttaccagttccattcctatctgctgcataa

DBGET integrated database retrieval system