Selaginella moellendorffii: SELMODRAFT_173570 Help Entry SELMODRAFT_173570 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism smo  Selaginella moellendorffii Pathway smo03020   RNA polymerase smo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SELMODRAFT_173570   09124 Replication and repair    03420 Nucleotide excision repair     SELMODRAFT_173570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smo03021]     SELMODRAFT_173570    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_173570 Transcription machinery [BR:smo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SELMODRAFT_173570   RNA polymerase III system    RNA polymerase III      SELMODRAFT_173570   RNA polymerase I system    RNA polymerase I      SELMODRAFT_173570 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SELMODRAFT_173570 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD DUF5816 zinc_ribbon_13 DZR zf-ribbon_3 HypA A2L_zn_ribbon DUF1451 Motif Other DBs NCBI-GeneID:  9642373 NCBI-ProteinID:  XP_002973594 JGI:  173570 UniProt:  D8RRJ3 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MDNAGGSGAGGSGVLAPPPPIEPVTYMCGDCGTDNSLKPGDVIQCRECGYRILYKKRTRR IVQYEAR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggacaacgctggtggatcaggcgctggtggaagtggggtcttggctccgccaccgccg attgagccagtgacttacatgtgtggagattgtggaaccgacaattcgctcaagcctggg gatgtgatacagtgccgggaatgcggctatcgcatcctctacaagaagagaactcgaagg attgtgcagtatgaagcacgctag

DBGET integrated database retrieval system