Streptomyces mobaraensis: J7W19_01290 Help Entry J7W19_01290       CDS       T07674                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism smob  Streptomyces mobaraensis Pathway smob00261   Monobactam biosynthesis smob01100   Metabolic pathways smob01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smob00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J7W19_01290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smob01008]     J7W19_01290 Polyketide biosynthesis proteins [BR:smob01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J7W19_01290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH SpuA_C Motif Other DBs NCBI-ProteinID:  QTT72243 LinkDB All DBs Position complement(346343..346552) Genome browser AA seq 69 aa AA seqDB search MSATNPFEDNDARYYVLVNAENQHSLWPVFAEVPAGWTVVHGEDSLQGCTEYVDANWTDM RPASLAARS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgccaccaaccccttcgaggacaacgacgcccgctactacgtcctcgtcaacgcc gagaaccagcactcgctgtggccggtgttcgcggaggtcccggccggctggaccgtcgtg cacggcgaggacagcctccagggctgcaccgagtacgtggacgccaactggacggacatg cgcccggccagtctcgccgcgcggtcctga

DBGET integrated database retrieval system