Streptomyces mobaraensis: J7W19_03365 Help Entry J7W19_03365       CDS       T07674                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism smob  Streptomyces mobaraensis Pathway smob00261   Monobactam biosynthesis smob01100   Metabolic pathways smob01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smob00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J7W19_03365  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smob01008]     J7W19_03365 Polyketide biosynthesis proteins [BR:smob01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J7W19_03365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QTT72606 LinkDB All DBs Position 926310..926522 Genome browser AA seq 70 aa AA seqDB search MSNPFEDESGTYRVLVNDENQHSLWPDFAEVPAGWAVAHGPAPHGECVDYVERHWTDMRP ASLSRRASAA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggacgagagcgggacgtaccgcgtcctcgtcaacgacgagaac cagcactccctctggccggacttcgccgaggtgcccgccgggtgggccgtggcgcacggc ccggccccccacggcgagtgcgtcgactacgtcgagcgccactggacggacatgcggccg gcgtcgctgtcccggcgggcgtccgccgcgtga

DBGET integrated database retrieval system