Serratia marcescens WW4: SMWW4_v1c24630 Help Entry SMWW4_v1c24630    CDS       T02448                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism smw  Serratia marcescens WW4 Pathway smw00261   Monobactam biosynthesis smw01100   Metabolic pathways smw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SMWW4_v1c24630  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:smw01008]     SMWW4_v1c24630 Polyketide biosynthesis proteins [BR:smw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SMWW4_v1c24630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGE18260 LinkDB All DBs Position complement(2663580..2663804) Genome browser AA seq 74 aa AA seqDB search MTQEQQNPFDDESLRFSVLVNAQQQYSLWPQFADTPQGWRVLMGPASRGECIDYIETHWQ DMRPAALKAADAAR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgactcaggaacaacaaaacccgttcgatgacgaaagcctccgtttctccgtgctggtc aacgcgcagcagcagtattcgctgtggccgcagtttgccgatacgccgcaggggtggcgc gtgctgatggggccggcgtcgcgcggcgagtgcatcgactacatcgaaacgcactggcag gacatgcggccggcggcgctgaaagcggcggatgcggcgcgttaa

DBGET integrated database retrieval system