Stackebrandtia nassauensis: Snas_4056 Help Entry Snas_4056         CDS       T01194                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism sna  Stackebrandtia nassauensis Pathway sna00261   Monobactam biosynthesis sna01100   Metabolic pathways sna01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sna00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Snas_4056  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sna01008]     Snas_4056 Polyketide biosynthesis proteins [BR:sna01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Snas_4056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADD43708 UniProt:  D3Q0V8 LinkDB All DBs Position 4330620..4330826 Genome browser AA seq 68 aa AA seqDB search MFEDNDGREYVVVRNDVNQYSIWPSDRQPPTGWAPAGRTGSKADCLAEIAEVWTDMRPAP RTGTDAHV NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgttcgaagacaatgacggccgcgagtacgtcgtggtgcgcaacgatgtcaaccagtac tcgatctggcccagcgaccggcagccgcccaccggctgggccccggcgggccgcaccggt tccaaggccgactgcctggccgagatcgccgaggtgtggaccgacatgcgtccggccccc cgaaccgggaccgatgcccatgtttga

DBGET integrated database retrieval system