Streptomonospora nanhaiensis: OUQ99_13430 Help Entry OUQ99_13430       CDS       T08686                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snah  Streptomonospora nanhaiensis Pathway snah00261   Monobactam biosynthesis snah01100   Metabolic pathways snah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snah00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OUQ99_13430  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snah01008]     OUQ99_13430 Polyketide biosynthesis proteins [BR:snah01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OUQ99_13430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAE76009 LinkDB All DBs Position 3130393..3130602 Genome browser AA seq 69 aa AA seqDB search MSNPFDDEDGRFLVLVNDEGQHSLWPAFAEVPRGWRVAQGETSRAEALEYVEREWTDLRP ASLIAAQEG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgagcaaccccttcgacgacgaggacggccgtttcctggtgctggtcaacgacgaggga cagcactccctgtggcccgccttcgccgaggtgccccgggggtggcgggtggcccagggc gagacctcccgggccgaggcgctggagtacgtggagcgcgagtggaccgacctgcgtccg gcgagcctgatcgccgcgcaggagggctga

DBGET integrated database retrieval system