Streptomonospora nanhaiensis: OUQ99_18250 Help Entry OUQ99_18250       CDS       T08686                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snah  Streptomonospora nanhaiensis Pathway snah00261   Monobactam biosynthesis snah01100   Metabolic pathways snah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snah00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OUQ99_18250  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snah01008]     OUQ99_18250 Polyketide biosynthesis proteins [BR:snah01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OUQ99_18250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WAE76649 LinkDB All DBs Position complement(4185896..4186111) Genome browser AA seq 71 aa AA seqDB search MTNPFDAEDGTFLVLRNAEGQYSLWPGHIAVPAGWESVFGPAGREECTRHIDSEWTDMRP ASLVRQAEAGA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgacgccgaggacggtaccttcctcgtgctcaggaacgccgagggg cagtactcgctgtggcccgggcacatcgcggtgcccgccggctgggagagcgtgttcggt ccggccggccgggaggagtgcacccggcacatcgacagcgagtggaccgacatgcggccc gcgagcctggtccggcaggcggaagccggcgcctga

DBGET integrated database retrieval system