Streptomyces nojiriensis: JYK04_04768 Help Entry JYK04_04768       CDS       T07326                                  Symbol mbtH_3 Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism snf  Streptomyces nojiriensis Pathway snf00261   Monobactam biosynthesis snf01100   Metabolic pathways snf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JYK04_04768 (mbtH_3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snf01008]     JYK04_04768 (mbtH_3) Polyketide biosynthesis proteins [BR:snf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JYK04_04768 (mbtH_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QTI46927 LinkDB All DBs Position 5070081..5070251 Genome browser AA seq 56 aa AA seqDB search MGRFTVVVNGEEQYSIWAEGREVPLGWRDTGVAGTKEECLAHIDEVWTDQRPLSVR NT seq 171 nt NT seq  +upstreamnt  +downstreamnt gtggggcggttcaccgttgtcgtcaacggcgaagagcagtactcgatctgggccgagggg cgcgaagtgcccctgggctggcgggacacgggtgtggccgggaccaaggaggagtgcctc gcgcacatcgacgaggtgtggacggaccagcgcccgctgagcgtgcgttag

DBGET integrated database retrieval system