Streptomyces nojiriensis: JYK04_07073 Help Entry JYK04_07073       CDS       T07326                                  Symbol mbtH_5 Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism snf  Streptomyces nojiriensis Pathway snf00261   Monobactam biosynthesis snf01100   Metabolic pathways snf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JYK04_07073 (mbtH_5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snf01008]     JYK04_07073 (mbtH_5) Polyketide biosynthesis proteins [BR:snf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JYK04_07073 (mbtH_5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QTI49202 LinkDB All DBs Position 7637151..7637375 Genome browser AA seq 74 aa AA seqDB search MSNPFENDNATYVVVRNDELQHSLWPAANPVPAGWTVVHGPDGRQACLDHVERVWTDMRP ASLVAALAGNAPRG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaacgacaacgccacctacgtcgtggtccgcaacgacgagctc cagcactccctgtggcccgccgccaaccccgtcccggccggctggaccgtggtgcacggc cccgacggccgccaggcctgcctggaccacgtcgagcgggtctggaccgatatgcgcccc gcctccctggtggccgccctcgccgggaacgcgccccgtggctga

DBGET integrated database retrieval system