Salvelinus namaycush (lake trout): 120033897 Help Entry 120033897         CDS       T07522                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism snh  Salvelinus namaycush (lake trout) Pathway snh00860   Porphyrin metabolism snh04216   Ferroptosis snh04217   Necroptosis Brite KEGG Orthology (KO) [BR:snh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     120033897  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     120033897    04217 Necroptosis     120033897  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:snh04147]     120033897 Enzymes [BR:snh01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      120033897 Exosome [BR:snh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120033897   Exosomal proteins of bladder cancer cells    120033897 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Aida_N Motif Other DBs NCBI-GeneID:  120033897 NCBI-ProteinID:  XP_038836206 UniProt:  A0A8U0U265 LinkDB All DBs Position Sna3:60130826..60132136 Genome browser AA seq 129 aa AA seqDB search MINMLMFSSYTYTSMVRRLQLATKGTIFLLYTVCMIMPDRDEWGNVLEAMQCALQLEKNV NQALLDLHKIASDKVDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAVKNKMAEYLF DKHTLGEQS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgatcaacatgttgatgttttcctcttatacatacacttcaatggtaaggagactgcaa ttggctaccaaggggacaattttcttgctctacacagtgtgtatgattatgccagatcgt gatgagtggggcaatgtgctggaggccatgcagtgtgctctgcagctggagaagaatgtg aaccaggccctgctggacctgcacaagattgcctctgacaaggttgacccccatctgtgt gacttcctggagacccattacctgaacgagcaggtggaggccattaagaagctgggtgac cacatcaccaacctcaccaagatggatgctgtcaaaaacaagatggcagagtacctgttt gacaagcacaccctgggagaacagagctaa

DBGET integrated database retrieval system