Streptomyces nigrescens: HEK616_51380 Help Entry HEK616_51380      CDS       T08756                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism snig  Streptomyces nigrescens Pathway snig00261   Monobactam biosynthesis snig01100   Metabolic pathways snig01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snig00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEK616_51380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snig01008]     HEK616_51380 Polyketide biosynthesis proteins [BR:snig01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEK616_51380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH WW Motif Other DBs NCBI-ProteinID:  BDM71651 LinkDB All DBs Position 5629556..5629780 Genome browser AA seq 74 aa AA seqDB search MNPFDDADGTFKVLVNAEGQYSLWPSFAEVPEGWEVRLDDRGRAECTAYIEEHWTDLRPA SLVAAMAAAQDGRG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgacgcggacggcacgttcaaggtcctggtcaacgccgagggccag tactccctgtggccgtcgttcgccgaggtcccggaaggctgggaggtgcggctggacgac cgcgggcgggcggagtgcaccgcgtacatcgaggagcactggacggacctgcggccggcc tccctggtggcggcgatggccgcggcgcaggacggcaggggctga

DBGET integrated database retrieval system