Streptomyces nigrescens: HEK616_75220 Help Entry HEK616_75220      CDS       T08756                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism snig  Streptomyces nigrescens Pathway snig00261   Monobactam biosynthesis snig01100   Metabolic pathways snig01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snig00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEK616_75220 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snig01008]     HEK616_75220 (mbtH) Polyketide biosynthesis proteins [BR:snig01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEK616_75220 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BDM74035 LinkDB All DBs Position SNP1:96783..96986 Genome browser AA seq 67 aa AA seqDB search MDENARYQVLRNDEDQYSLWLADLEIPAGWHAVGKEGTQDECSAYVDEVWTDMRPRSLRE RMENADA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggacgagaacgcccgctaccaggtcctgcgcaacgacgaggaccagtactcgctctgg ctcgccgacctggagatccccgccggctggcacgccgtcggcaaggagggcacccaggac gagtgctccgcctacgtcgacgaggtctggaccgacatgcgcccccgcagcctgcgggag cgcatggagaacgccgacgcctga

DBGET integrated database retrieval system