Streptomyces nitrosporeus: CP967_01520 Help Entry CP967_01520       CDS       T06889                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snk  Streptomyces nitrosporeus Pathway snk00261   Monobactam biosynthesis snk01100   Metabolic pathways snk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP967_01520  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snk01008]     CP967_01520 Polyketide biosynthesis proteins [BR:snk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP967_01520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU70805 UniProt:  A0A5J6F6Y1 LinkDB All DBs Position 323199..323384 Genome browser AA seq 61 aa AA seqDB search MSGEAGPFDPAAGESGTHLVLENSAGRTSLWPVWREVPAGWSVRFGPAPYASCVTVLEPA R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgagcggtgaggcaggcccgttcgatccggcggccggggagagcggcacccatctggtg ctggagaactccgcggggcgtacgtccctgtggccggtgtggcgcgaggtgcccgcgggg tggtcggtgcgcttcgggccggctccgtacgcctcctgcgtgaccgtgctggagccggcc cggtga

DBGET integrated database retrieval system