Streptomyces nitrosporeus: CP967_07080 Help Entry CP967_07080       CDS       T06889                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snk  Streptomyces nitrosporeus Pathway snk00261   Monobactam biosynthesis snk01100   Metabolic pathways snk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP967_07080  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snk01008]     CP967_07080 Polyketide biosynthesis proteins [BR:snk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP967_07080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU71757 UniProt:  A0A5J6F7D4 LinkDB All DBs Position complement(1657270..1657488) Genome browser AA seq 72 aa AA seqDB search MANPFDDESGRFVVLVNDEAQYSLWPAHIDIPDGWRVEGREGTRQECLEAVETVWTDMRP AGLVRAMEADAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggccaatcctttcgatgacgagtcggggcggttcgtggtcctggtgaacgatgaggcc cagtactcgctgtggcccgcgcacatcgacatcccggacggctggcgtgtcgagggccgg gaaggcacgcgccaggaatgtctggaggcggtggagaccgtgtggaccgatatgcggccc gccggcctggtgcgggcgatggaggccgacgccggctga

DBGET integrated database retrieval system