Streptomyces nitrosporeus: CP967_19575 Help Entry CP967_19575       CDS       T06889                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism snk  Streptomyces nitrosporeus Pathway snk00261   Monobactam biosynthesis snk01100   Metabolic pathways snk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP967_19575  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snk01008]     CP967_19575 Polyketide biosynthesis proteins [BR:snk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP967_19575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU73895 UniProt:  A0A5J6FG13 LinkDB All DBs Position 4376857..4377075 Genome browser AA seq 72 aa AA seqDB search MADEQTDNRVYRVVLNDEEQYSIWDADRELPAGWHAEGTEGARQVCLDRIEEVWTDMRPA SLRRRMAETGAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctgacgagcagaccgacaaccgtgtctaccgggtcgtcctgaacgacgaggagcag tactcgatctgggacgcggaccgcgagctgccggccggctggcacgccgagggcaccgag ggcgcccgccaggtctgcctggaccggatcgaggaggtctggacggacatgcgcccggcg agcctgcgccgccgcatggcggagaccggcgccgcctga

DBGET integrated database retrieval system