Streptomyces nodosus: CP978_34180 Help Entry CP978_34180       CDS       T06839                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snq  Streptomyces nodosus Pathway snq00261   Monobactam biosynthesis snq01100   Metabolic pathways snq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP978_34180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snq01008]     CP978_34180 Polyketide biosynthesis proteins [BR:snq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP978_34180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV42917 UniProt:  A0A0B5DL09 LinkDB All DBs Position 7689595..7689807 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDTEGRFLVLVNDEGQHSLWPSFADVPGGWTTVFGEDTRQACLDHIEAHWTDLR PRSLVASTDT NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacaccgaaggccgcttcctggtcctcgtgaacgacgag ggccagcactccctgtggccgtccttcgcggacgtgcccggagggtggaccaccgtcttc ggcgaggacacccggcaggcatgcctcgaccacatcgaggcccactggacggatctgcgt ccccggtccctcgtggcctccacggacacatga

DBGET integrated database retrieval system